top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|55719313|55731586|+|RRAGB|ENST00000262850.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

38

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

DLVGATK

Amino Acids from 5' Exons

VGATKYSHEEK,WVLPNTAMKKK,GCYQIQPRK

Amino Acids from 3' Exons

ARHLHGKLFHPTGQHLPKCGGSDLCLCGEPRTGKGHALLPIMPGGHSAEFSRCQNILLGTQNGSGTGGSTGP,QDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDL,KTPSWKIISLANGTTSSEMWRFFMSLMWRAANWKRTCTITNHAWRPFCRILQMPKYFAWYTKWIWYRRINGT

bottom of page