top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|50633177|50695937|-|SHROOM4|ENST00000289292.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.967

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

VHAPLQEEPMTSPAK

Amino Acids from 5' Exons

RVCAVVSTLPALQHREKQLHWQHGEPGATRPSHLEPSVAYPEHVPPALSLQLLLGQLKCFLCPFPQARGASLYRLHHARPRANGPQWPACGDLRRSAHQWGPPDPQLSDVIPSTGGIPVRARQSSQGPTTTSSEAGQPSGLQSPTPQWRAAQGIACGPLATEGETELRACATRKEPVLLPQWAPSDKGPSELVQSASIQPTGLASTDAGLNQSCWIPKSLQSFQRGFQPTQGFCRASGFFWQTSTSHRTHRASPCPTAAGIPPAACAPYQGQQRDGAPTRTGWAPVDSVPFAQQPQREEKSMPPYRRNPPVQQRKKDQTSGQVFSFGTPEPKQSPTWRGWTPLRKRFPGPKQNKQSSQIGQPATLCLWLPCSTSHGLFFNHSSWHRGRRRGQRAQGVQPDGWAKWRDPGPLDPKPAEEAFCYQSANSEEEGPAPEKQGSLVTAVHGASGRDPGAPRKSSTHCLHISSIFMKTSQPQRQALQQKHDAQSVFRVPQPSPEPIDRLRGTNKPWPEAWPVLFGPEHLVESTPILLRPESTCSLWSPWRSLEMVSRAFTATCGSSHGRPFQPRQQGIEGFYCSSWGGCHPLAFCRQKKVLREQILIYISFARFNHSQQDFYPETKTYRPKLPANELQLGIEAPSHGPIISFRRPTISCHRPIISFHVTPSVRNSHLLRMFCKQRSRKFHVLATTLWFLPQDLLLLLQCSRSSSPSLHLLFWGNLPCLAKEKYDAKLLQLPVPPPPMHSVFSLLSSSAQCPRGQQLGTWQHLETQEADSA,DVCVQWCPLSRHCSTEKSSSIGSMESLEQPGQATYESHLLPIDQNMYPNQRDSAYSSFSASSNASDCALSLRPEEPASTDCIMQGPGPTKAPSGRPNVAETSGGSRRTNGGHLTPSSQMSSRPQEGYQSGPAKAVRGPPQPPVRRDSLQASRAQLLNGEQRRASEPVVPLPQKEKLSLEPVLPARNPNRFCCLSGHDQVTSEGHQNCEFSQPPESSQQGSEHLLMQASTKAVGSPKACDRASSVDSNPLNEASAELAKASFGRPPHLIGPTGHRHSAPEQLLASHLQHVHLDTRGSKGMELPPVQDGHQWTLSPLHSSHKGKKSPCPPTGGTHDQSSKERKTRQVDDRSLVLGHQSQSSPPHGEADGHPSEKGFLDPNRTSRAASELANQQPSASGSLVQQATDCSSTTKAASGTEAGEEGDSEPKECSRMGGRRSGGTRGRSIQNRRKSERFATNLRNEIQRRKAQLQKSKGPLSQLCDTKEPVEETQEPPESPPLTASNTSLLSSCKKPPSPRDKLFNKSMMLRARSSECLSQAPESHESRTGLEGRISPGQRPGQSSLGLNTWWKAPDPSSSDPEKAHAHCGVRGGHWRWSPEHNSQPLVAAAMEGPSNPGDNKELKASTAQAGEDAILLPFADRRKFFEESSKSLSTSHLPGLTTHSNKTFTQRPKPIDQNFQPMSSSCRELRRHPMDQSYHSADQPYHATDQSYHSMSPLQSETPTYSECFASKGLENSMCCKPLHCGDFDYHRTCSYSCSVQGALVHDPCIYCSGEICPALLKRNMMPNCYNCRCHHHQCIRCSVCYHNPQHSALEDSSLAPGNTWKPRKLTVQ,TCVCSGVHSPGIAAPRKAAPLAAWRAWSNQAKPPMRAICCLLTRTCTLTSVTQPTAPSRPAQMLLTVPFPSGQRSQPLQTASCKAQGQLRPPVAGLMWLRPQEVVGAPMGATPPALRCHPVHRRDTSQGPPKQSGAHHNLQGGTAFRPPEPNSSMESSAGHLSLWSPCHRRRNASLCYPQGTLIGSVASVGMTKQVRAIRTVSSVSLLNPANRALSIYCRPQPKLLDPQKPVTELPAWIPTHSMRLLQSLRLLLADLHISDPQGIAIVPLNSCWHPTCSMCTLIPGAAKGWSSHPYRMGTSGLCPLCTAATKGRKVHAPLQEEPMTSPAKKERPDKWMTGLFWDTRAKAVPHMERLMDTPQKKVSWTQTEQAEQPVNWPTSNPLPLAPLFNKPRTVLQPLKQLVAQRQVKKGTASPRSAAGWVVGEVEGPGAARSKTGGRVSVLLPICVMKFRGGRPSSRKARVPCHSCVTLRSQWKRPRSPQKVLHSLPLTHLFYLHVKNLPAPETSSSTKACSELGLPSASAKPLRAMNLGQARDEALARGLASPLWATPGGKHLTHPPQTLRKHMLTVESVEVIGDGLQSIIHSHLWQQPWKALPTQVTTRNRLLLLKLGRMPSSCLLQTEESSLKRVANPYLHLICQVPLIATRLLPRDQNLTKTSSQAPAVGNGAIPWTNHIIPQTNHIMPQTNHIIPCHPFSQKLPLTQNVLQAKVKIPCVVSHYTVVILITTGPALTPAVFKELSMILAFIVLGKSALPCREICQIATTAGATTTNAFGVQFAIIILSTVPSRTAAWHLATLGNPGSQC

Amino Acids from 3' Exons

IEDGGKAALSQKMRTGDELVNINGTPLYGSRQEALILIKGSFRILKLIVR,LKMEARQLCPRRGLVMSWISMALHYMAPAKRPSFSSKAPSGFSSLSG,RWRQGSFVPEDEDWAGEYQWHSIIWLPPRGPHSHQRLLPDSQADCQE

bottom of page