top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|47180211|47181401|+|RBM10|ENST00000329236.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9815

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

RAMATAR

Amino Acids from 5' Exons

EAAQLLQILQALHPPLTIDGKTINVEFAKGSK,RQPSCCRSCRPCTHHSLSTARPSMLSLPRVLR,GSPAAADPAGPAPTTHYRRQDHQCVCQGFE

Amino Acids from 3' Exons

ASQGGEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGA,PPKVGRVPGPPPRSRRSTTATTNRMRAMATARAQSLPSMPMATSRAPRALASLEPKGIPLEQ,LPRWGGYLGHLRGAAGRLQLLPTGGLWQQPGHRVFPLCPWLPQGHQGPWHHWNQRGSHWS

bottom of page