top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|40591233|40597664|+|ATP6AP2|ENST00000378438.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9833

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

4

Peptide

NNEDLSWPGLAVGNLFHRPR

Amino Acids from 5' Exons

DLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLEN,TFLGQDSQWVTCFIVLGLPSWWRETNWLYPQAVSFRTLWR,PFLARTRSGPVSSSSGYRHGDGEGSEQTGSTPRQCHFVPFGE

Amino Acids from 3' Exons

RVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNE,ECIWGRQTQCLKTFQSPCASSVIACFKKTLFSVHSPSILVGTM,SVYGREGKLSVRPFSHLAPAPSPVSRKLCSQFTPPQFSEEQ

bottom of page