top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|29282937|29920094|+|IL1RAPL1|ENST00000378993.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9617

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

KVTWEITPVMLK

Amino Acids from 5' Exons

PMDALTGLSISRNIKFWWESLFESNVHSFMVISEQITPLPKVLDSVCGTKVLVLETLKSQPLTEVEAKKKTPFGSGQHCYRTVVSTPVSS,RWMHLVYRYQEISSFGGRACSNQMCTLLWLYQNKLLPCPKCWTQFDVVQKFWSWRLRANSLRKNEQRRRLHLVPANIATGQWSLRLCHQ,DGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI

Amino Acids from 3' Exons

NSGASWGTGSFHLINCGLCGRRLGKLLLLCKWKWTSTRQRSPST,ILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKR,FLRSILGNRKFPSHLWTLWKKVTWEITPVMLKMEMDVDTPAFSFINE

bottom of page