top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|154441622|154442428|+|GDI1|ENST00000447750.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9824

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

LYEPIDDGCESQVAR

Amino Acids from 5' Exons

VARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKS,WPAASSSVTPATSRTVCGRLARLSASSVSLATPSRTPTTPTPAKSSPRTRSTGSQ,GPLQAADLPQLHPGPCAEGWPGYPHHLYPPPHQEHQRRQLLPNNHPPEPGQQEV

Amino Acids from 3' Exons

VCGYQLVAHWLEP,FVAISDLYEPIDDGCESQ,LWLSVTCMSPLMMVVRA

bottom of page