top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|120536926|120560625|-|CUL4B|ENST00000336592.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9128

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

LADICAYGSSFTTR

Amino Acids from 5' Exons

YMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPE,ICRIRMFREILSLISQWAIGRHMCLWKFIYHQ,YAESECSGKYVNCEYPDNGLLADICAYGSSFTTR

Amino Acids from 3' Exons

VFLPPVPQLLLLLRRSDLPLMVIPAPLRPPLPRRESTAAAVAAVTVVTREKTLIPPLPPLPLLLYNPGIRHPLQPRPSAWGFQWLLPATYRYRRSCVLKTPWSLGLMRRWLRNPPPPPPHLHQLLQHLSSSNLKIRVYSLLWLRCIMQTAPNLLPPSLALLTANLALLRSSRTLK,FFFPQSLSCCCCSGGQICHWYQHHSAHLCQEEKVKQQQQQQQRERRLFHLFLLFHSSFTTQGFGIPFNLVLLPGGFSGCFQPRTDTEEAAFRHPGVCRVCEDGGILLLLLLIFTNCCNISAAATKEYINLFCGFGASCKRPSQIFYHRLLCQQTWLCEVSDQEL,FSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFK

bottom of page