top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|95923259|95973088|+|ERCC6L2|ENST00000479391.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9878

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

FLGNTYQK

Amino Acids from 5' Exons

ETLIKRICDQVFSRFPDFVQKSKDAAFETLSDPKYSGKMK,KHLSKGYVIRYFPDSQILCRKAKMQPLKHFLTLNTVEK,NTYQKDMSGIFQIPRFCAEKQRCSLNTFPIQWKNE

Amino Acids from 3' Exons

PRQPDCQECRGTEQAAEPLAKEACDLCSDFSDEEPVGATGIKTAKNKAPDSSKASSSPGQLTLLQCGFSKLLETKCKAVEDSDGNTASDDESSDEQPTCLSTEAKDAGCEKNQDSLGTSKHQKLDNILNPKEKHIFYKSEKILEQNISSKSDEKKIKNTDKHCILQNVTESEDSDVICPTQYTTERFPDNSIRFKPPLEGSEDSETEHTVKTRNNDNSRNTDDKRNGIISKKLSPENTTLKSILKRKGTSDISDESDDIEISSKSRVRKRASSLRFKRIKETKKELHNSPKTMNKTNQVYAANEDHNSQFIDDYSSSDESLSVSHFSFSKQSHRPRTIRDRTSFSSKLPSHNKKNSTFIPRKPMKCSNEKVVNQEQSYESMDKFL,LDSLTVRNAEVQNKLQSHWQRKHVISAVTSVMKSQWEPQERLPKTKHPIQVKLPALQDSLPYSSVVSRNCLKQNVKQLRIVMEILPLMMKVLMSSPHAFQQKPKMLVVRKIRTLLVLQNIRNITSIQKKSIFFIKVRRFNRIFLPSLTRKKLKIQINIAFYRMSQNQKIVMSSVLHNTQLRDSPTIVGLSHPWKDLRILKQNTLKQEIMIIVETLMTKEMEFQKSVLRTQPNLFKEKAPVISVMNLMTLKFLPSQEERELVHGLREKKPKKNFTILPKQTKQTKCMQQMRIITLSLLMIIHPQMRVYPSATSVSLNRATDQELETELVFLQNCLAIIRKIALLFQENQNVQMRKLLIKSSRMNQWINF,TALSGMQRYRTSCRATGKGSMSLQLQRASGSHRNKDCQKQSTRFKSFQLSRTAYLTPVWFLEIANKMSSGWKYCLKFAAHMPFNRSQRCWLEKSGLSWYFKTSEIRHPKSKRKAYFLKEDFRTEYFFQVREKNKYRTLHFTECHRIRRCHLSYTIHNEIPRQYKVATLGRIGFNRTHCKNKKSKHQKKWNNFKKVKSEHNPEIYFEKKRHQYQIHNFFQVKSKKESFIEVENKRNQKRTSQFSQNNEQNKPSVCSKGSLSVYLFILREFIRQPLQFLTEPQTKNYKRQNFFFKIAPEKHFYSKKTNEMFKESCSRAVVINGIF

bottom of page