top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|90874671|90878953|+|SYK|ENST00000375746.1

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9435

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

EKPYPWTQR

Amino Acids from 5' Exons

APREKPYPWTQRCTRAPTRTPRRSGPRRFTWTESCRWKTKNWALVILELKRATTKK,PPERSPTHGHRGVREPLRGPRGDQAQGGLPGPKAADAGRQRTGLWFWNCEKGLLPNEK,PQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMK

Amino Acids from 3' Exons

TCQGEHHRTGSSGFHGHEVLGGEQFCAQRSGCKKCVASYPTLRQDQFRTFQSTACKLLQ,HVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYK,MSRIRTSNWFIRFPWASTWRRAILCTEIWLQEMCCLPNITPRSVISDFPKHCVLMKTTT

bottom of page