top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|5064882|5123121|+|JAK2|ENST00000381652.3

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9133

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

SPPAEIELSSLR

Amino Acids from 5' Exons

EIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPI,KLNLAHGKLCLSCHLMDIIDLQMHIITSVKKHLQPCLKIYKATVMAQF,NTLIKGSFVFRVINWILINCRCTSLPLRSSTSSRAKYTKQLSWPNF

Amino Acids from 3' Exons

VCSRITDREQVFCGLRCLELWSGSVTFHIHEEKSTS,YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPA,MLQNHQRASFLWPQMFGALEWFCMNFSHTLRRVKVHQ

bottom of page