top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|33115990|33135424|-|B4GALT1|ENST00000379731.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9125

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

MDFLIIIGAGEEK

Amino Acids from 5' Exons

PTLCSVFWRCLCSKTTVSNHQWISLLGLGRRRHFQ,LPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFN,YLMFSILEVSLLVNNSFPSMDFLIIIGAGEEKMMTFLT

Amino Acids from 3' Exons

WAPCLSLTCLWTWSSWQSRTQMRWAAAMPPGTASLLTRWPSSFHSATGRSTSSTGYIICTQSCSASSWTMASMLST,GPHADVHACGPGARGKAEPKCEDGRPLCPQGLRLSSQGGHHHSIPQPAGAPQVLAILFAPSPAAPAAGLWHLCYQP,GPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQ

bottom of page