top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|137813005|137816062|+|EHMT1|ENST00000460843.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

VLLLEELPK

Amino Acids from 5' Exons

PLSFSGFRCHLKEQGRRDAPAVCEPQLSGVERSADEQGSAGLGPRQAQPRGEDSEQ,LFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVS,SFFLGIQMSPRTRKERRPCSVRASTLRCGALCRARLCRTRPPTGPAPWRGA

Amino Acids from 3' Exons

DGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGL,MAGSCQSSTWRSLPSSNATTRAPAGGTAEIASYRMVS,WPAPARVQHGGASLDLRMQPRVLLLEELPKSRRTEWSQ

bottom of page