top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|121088295|121107995|+|CNTRL|ENST00000238341.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9964

42

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

NELVLMNTWLYSCNEER

Amino Acids from 5' Exons

VLMNTWLYSCNEERFSTKNILQSKDTIIISLSYPIIYVQYEIVTFTFDWIRDSTFSFWRTVVASDCRKQYAFGLSRP,FTPGFILAMKKGSQQKIFSKAKIPSSSHSPIPSSMSNMRSRSLSPLIGSETLPFHSGGQWCEQVEIADENNMLLDYQDHK,FDEHLALFLQRKVLNKKYSPKQRYHHHLTLLSHHLCPIDLGHFHLLDQRLYLFILEDSGVSKLRLQMKTICFWTIKTIK

Amino Acids from 3' Exons

KRKDWKETKKRKLKSLRANKQGSLRKLKIKININHKRRPCYRNRAVRNSRVTTQKMN,RGRKTGKRPRKKDDRNRAEQTNKVPGNKSRIEIIKRGGHVTETELGTQELKHKKI,EVERLERDLEKKMIETEELKSKQTRFLEEIKNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNEL

bottom of page