top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|86532508|86556338|+|CPNE3|ENST00000198765.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9091

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

QFQNISAEEIK

Amino Acids from 5' Exons

ISAEEIKDNRVVLFEMEARKLDNK,FQLKKKIIEWSCLKWKPENWII,FSRNKRSGLVNGSQKTG

Amino Acids from 3' Exons

QYFVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLRSPLGEVAIRDIVQFVPFRQFQN,NILCFLLLMVSQTLMKPDKLLMPPGCLCPSLLELEVLTSAPWSFWMVMVEVSAPHWAKWPSEILSSLCLSDSSR,IFCAFDYYWCDHRPNQTSYSCLQAAYVHHNCWSWRCLQRHGVSGWWWKSPLPIGRSGHQRYCPVCAFQTVPE

bottom of page