top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|84529298|84804802|+|RALYL|ENST00000517638.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9342

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

NLSCLLGLK

Amino Acids from 5' Exons

DSKESQSLAKHRPATSPIRMTPSPSTPVFSSAIIRQLSRKLTLKPFFQSMEKLDVPFTKVMHLYSTVSDMQELQWLEKMPESSPANHL,IKARRANHDWQNTDQQRHQEPQVHQLPCFHRQSKYGNCQESHSHFFKVWKNSWMFRSQRLCICTVHEATCKSCSGWRKCQSHRRPTT,LKQGEPIMTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPL

Amino Acids from 3' Exons

TIKGTFPVCW,LESKEPFLSV,LNQRNLSCLL

bottom of page