top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|70170201|70214075|-|NCOA2|ENST00000452400.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9105

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

NVIVNRK

Amino Acids from 5' Exons

ALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI,PLMGSSLTWKATLCLCQRMHSIGITKKSTKVYIASCMLGTTRNLSKTCCQSL,PWVLLCSEPGRQRCVCVRECDTVSKVPRRADEQKCIHLACWGPHGICQKPAAKVY

Amino Acids from 3' Exons

PQKEHKTSTGKIYRRTCRVDFCKFYRQLLQTQMCNLKRNCEANSSDQRT,PKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQ,PKGTLKNVIVNRKINIKNLQSFLQILMITTLTSNLTNVQSKKLSKFVRSKNK

bottom of page