top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|69621034|69629679|+|SULF1|ENST00000260128.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9139

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

MTTTTGR

Amino Acids from 5' Exons

KWQCIEDTSGKLRIHKCKGPSDLLTVRQSTRNLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTP,SGNALRIHLASFEFTSVKDPVTCSQSGRARGTSTLAASMTKTKSAVVGSLVTVPAEAKERVNGNSETRGLQ,VAMHGYIWQASNSQVRTQPAHSPAEHAEPLRSRLPQRQRVQLGVWLPCQQKPKKESTAILEKPGDS

Amino Acids from 3' Exons

GGCSGSRQTATFQGEQPEEEGEEGEETAEEGGRVQPAWPHLLHAQQPLADSPVLE,EAAQEVDSKLQLFKENNRRRKKERKEKRRQRKGEECSLPGLTCFTHDNNHWQTAPFWN,RLLRKIANCNFSRRTTVGGRRRGRRRDGRGRGKSAACLASLASRMTTTTGRQPRSGT

bottom of page