top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|668597|716007|-|ERICH1|ENST00000262109.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9851

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

4

Peptide

HALEMFPEHCTMPPVFVEK

Amino Acids from 5' Exons

VSPEMQLQLPSQMPLRSCWTALRHTACCPQTCPSCTTKRCCSCKILRDSMLWKCSQNIARCLL,CLQRCSFSCPRRCRGAAGPPCVTQHAALRRVHPVPHENAAAPARYEIEACSGNVPRTLHDAS,VSRDAASAALADAAEELLDRLASHSMLPSDVSILYHMKTLLLLQDTERLKHALEMFPEHCTMPP

Amino Acids from 3' Exons

CLWRRCCRDFFLLFQVAKERGNPRRWPSKIHQRKPLRKARNMLSLQ,VCGEGAAETFSSCSKWPRKEGTPDAGRPKSTKESDLESEPETCAFD,FVEKVLQRLFPPVPSGQGKREPQTLAVQNPPKKVTSEKVSQKHAEPLT

bottom of page