top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|25407982|25410202|+|DOCK5|ENST00000276440.11

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9232

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

MESRPLLSHLHLPPK

Amino Acids from 5' Exons

LNLGATFGAQGLVRCQSRSVPRGEQREPDQQVEKRLESEQVPGHCRESTRTRFD,SILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLM,QSWSHFWSAGPRQVPELKICPLERRTARTGSASLREKTGVASPRSLQRKHQNPI

Amino Acids from 3' Exons

APHRCRQMESRPLLSHLHLPPKASPMKAARGTPL,LPIVADRWNRGHSCPTSTSPQKQALRQPEELH,SPSLQTDGIAATPVPPPPPPKSKPYEGSQRNSTE

bottom of page