top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|141136508|141136791|+|DENND3|ENST00000518347.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

21

Peptide

HLSALLDPEVLSIFVPPFISK

Amino Acids from 5' Exons

VAYKKGVKHLSALLDPEVLSIFVPPFISKEDSQMAGANCGTLGKTRMRSLRKKREKPRPEQWKGLPGPPRAPEPEDVAVPGGVDLLTLPQLCFP,LLIKRESNIFLLFLIQRSCPFSCLLLSVKRTVKWPVPTAALSVKPGCAPERRERSPDQSSGRASRGPPERQSLRMSPSRAAWTSSPCRSCASQ,CLKGSQTSFCSSSRGPVHFRASFYQRGQSNGRCQLRHSRNPDALLEKEEREAQTRAVEGPPGAPQSARAGCRRPGRRGPPHPAAAVLP

Amino Acids from 3' Exons

VAYKKGVKHLSALLDPEVLSIFVPPFISKEDSQMAGANCGTLGKTRMRSLRKKREKPRPEQWKGLPGPPRAPEPEDVAVPGGVDLLTLPQLCFP,LLIKRESNIFLLFLIQRSCPFSCLLLSVKRTVKWPVPTAALSVKPGCAPERRERSPDQSSGRASRGPPERQSLRMSPSRAAWTSSPCRSCASQ,CLKGSQTSFCSSSRGPVHFRASFYQRGQSNGRCQLRHSRNPDALLEKEEREAQTRAVEGPPGAPQSARAGCRRPGRRGPPHPAAAVLP

bottom of page