top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|132777791|132817545|+|PHF20L1|ENST00000315808.14

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9708

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

GAPAAAGSEK

Amino Acids from 5' Exons

VVKREYRIGSQDEKAPKSPWNHFDWCSFGGTGLLTKM,KENTEEDLKMSKKPPNRPGITFEIGARLEALDYLQK,SEKRILKNRISRVKSPQIALESLLRLVLVWRHWTTYKN

Amino Acids from 3' Exons

CLMLHICHLRSWDPVSLLTVVVQKLQHRPQIPLTVMNVPGQKKRIHRCFQILLPKQLMEEELQQQQ,ACCTFATEAGTLSPSLKSWFRSYSTGSLRFLLPMSQGRKRGYTDASKSFFQSNSWKRSSSSS,PDVAHLPLEKLGPCLPLDLSRGSEVTAPVASDSSYRNECPRAEKEDTQMLPNPSSKAIADGRGAPAAA

bottom of page