top of page

McDonnell Genome Institute

Washington University

CircRNA

chr8|102311298|102312485|-|UBR5|ENST00000220959.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9457

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

AAVIIMAVEVLK

Amino Acids from 5' Exons

ESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPPISSLGMGVHSLINLPANSTIKKKAAVIIMAVE,NLPLFFEMEMVPSTQWPKIAWEEGIPIGWIFHLLVVLEWVCILIFLPIQQSKRKLLLSSWL,ISHYSSRWKWYHLPNGQRLHGRNKGSRLAGSSTYSWNGCAFFNKSSCQFNNQKESCCYHHGCR

Amino Acids from 3' Exons

VLKVDGAYVAVKFPGTSSNTNCQNSSGPDADPSSLLQDCRLLRIDELQ,CKMVPMLLNFQEPPVILTVRTALVQMLTLLLSCRIVGYLELMNC,AKSRWCLCCCKISRNLQYLSEQLWSRCPFFSPAGLVTNIA

bottom of page