top of page

McDonnell Genome Institute

Washington University

CircRNA

chr7|72890626|72926963|+|POM121|ENST00000395270.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9472

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

RSGGNWTLMR

Amino Acids from 5' Exons

GPVSFKDVAVDFTQEEWWQLDPDEKITYGDVMLENYSHLVSL,GQCHSKMWLWISPRRSGGNWTLMRRHTGMCWRTTAIFPW,ASVIQRCGCGFHPGGVVATGPEDNIRGCDVGELQPSSFP

Amino Acids from 3' Exons

TRADNQLNTVLTIKRPRPMCKGDSTECPQREGEEKDSGGRRPNIPWPGKKK,PEQIISSTLSSPSSNAPDPCAKETVLSALKEKEKKRTVEEEDQIFLDGQENKR,QSRSAQHCPHHQVTPQTHVQRRQYVPSKRRRRKGQWRKKTKYSLMARKIKE

bottom of page