top of page

McDonnell Genome Institute

Washington University

CircRNA

chr6|394820|401777|+|IRF4|ENST00000380956.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9794

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

LFDTQQFLSGLGTV

Amino Acids from 5' Exons

AWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKK,LGHCLKESSEKASTSRTLPPGRRACGALTRAMTLRNWLSGASWTSQTRTKCTGLFLREPKK,LGTVRKVPRRHRQAGPSHLEDAPAVRFEQEQLGTGAEPAGHLRPVQSVQDCSGSQK

Amino Acids from 3' Exons

TAGCTSACTTGKSSRSPRPAPRAAGSPMDIRMTPATWTRSCSPTQRTMARGKTLRSCATWRGAWSSGWPPTGSMRKDCARAGSTGTGPWRCATTGPTNWRETRPASSLTHSSSCQ,LPAAHLPVLPGNPREGADHVQPRGLPDLPWTYVRQQPGPGPVPLPRGQWPEEKHEAAEPPGEGRGPLDGPRRALCEKTVPEQDLLGRAPGAVQRPAQQTGERPDLQALHTAVLV,CRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLS

bottom of page