top of page

McDonnell Genome Institute

Washington University

CircRNA

chr6|135442581|135466373|-|AHI1|ENST00000265602.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9307

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

DIQLFPDTIR

Amino Acids from 5' Exons

ACRIPNKHLFSLNAGERGCFCLDFSHNGRILAAACASRDGYPII,LAVSQTNTSSHMQENEDVFVLISPTMEEYQQLVPAGMDIQLF,LPYPKQTPLLTKCRRTRMFLSFLPQWKNISSSLCQPGWISNY

Amino Acids from 3' Exons

PDTIRSNLPHIKETTSDDVSAANTNNLKKSTRVTKNKLRNTQLATENPNGDASVEEDKQGKPNKKVIKTVPQLTTQDLKPETPENKVDSTHQKTHTKPQPGVDHQKSEKANEGREETDLEEDEELMQAYQCHVTEEMAKEIKRKIRKKLKEQLTYFPSDTLFHDDKLSSEKRKKKKEVPVFSKAET,PTLLEAIFPILKKLQVMMVLLTLTTRRARESLKTNGTHSQLKILMVMLVRKTNKESQIKRRRCPSLHKTNRKLLRIRLILHTRKHIQSHSQALIIRKVRRQMREEKRLIKRMKNCKHISAMLKKWQRRLRGKERNKNSLTFPQILYSMMTNAVKKGKRKRKFQSSLKLKQ,RHYKQSSPYRNYKCKCCHQPEEEHESHKQIEEHTVSNKSWCCRGRQTRKAKKGDKDGAPVDYTRPETGNSEGFYTPENTYKATARRSSEKEGKGKRRDFRRGRIDASISVPCNRNGKGDEENKKETERTVDLLSLRYFIPQTKQKKEKEKGSSSLLSNK

bottom of page