top of page

McDonnell Genome Institute

Washington University

CircRNA

chr6|111674498|111699670|-|FYN|ENST00000368678.8

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9973

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

DAWEVAR

Amino Acids from 5' Exons

VQSSPSSGRPPRQPCTGGSQSSLTCGLLESYSQSWSPKEECHTQ,CKVPHQVDGPRGSPVREVHNQVRVVFWNLTHRAGHQRKSAIP,AKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYP

Amino Acids from 3' Exons

RKLMVCVLTLLHRVVPHKLLDWLKMLGKLHVVRCVWRRSWVRGVSLKCGL,ESWFVFLNCDCIELYPTNFWIGRCLGSCTSFVVSGEEAGSGVFRSVA,KADGLCFNLTVIASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFAEVWL

bottom of page