top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|31297288|31299631|+|CDH6|ENST00000265071.2

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9459

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

3

Peptide

FPQSTFVVQVTATDADDPTYGNSAK

Amino Acids from 5' Exons

VHLLSKSLRRMQMIQHMGTVLKLSTVFYRDSPIFQLNQKQ,YICCPSHCDGCRSNIWEQCSCLQYSTGTALFFSIRN,TFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSVESET

Amino Acids from 3' Exons

VLSRQLCSTWIEKTGSSTKWFKPRIWAARWEDYLGPPPTSHLMSTTTLPDSPR,YYQDSFAQHGSRKQGAVPSGDSSQGYGRPDGRIIWDHHREHHTDCQRQPSPIPP,IIKTALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQ

bottom of page