top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|177204119|177239865|+|NSD1|ENST00000347982.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9216

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

SYLSLGEEGNRK

Amino Acids from 5' Exons

FPTGGPIGSTTWRLLEILLREPGWLEKQSSCLKADINSKSYLSLGEEGNRKKKDIGI,FQPEALSAVLRGGFWRSFESLGGWKSNRHVRQTSIRRATCPEKRETERKRIA,SNRRPYRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHK

Amino Acids from 3' Exons

EIMKVNVKENQLRNFLNPMITLDLCPRRGTLAFLK,KLKTSKKTNETSIQFRPWIYAQEGGPWPFK,NYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKK

bottom of page