top of page

McDonnell Genome Institute

Washington University

CircRNA

chr4|75752372|75782858|+|USO1|ENST00000264904.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

VTNLHLMLQIQK

Amino Acids from 5' Exons

IQKLCDRVASSTLLDDRRNAVRALKSLSK,FKSFVTELHLLYWMIEEMLFVLSNHYL,SKALQSSFIYFIGSKKCCSCSQIII

Amino Acids from 3' Exons

VLKIVFCSKTYKTTTPIKIFLKKAHIFNVNLGLKLEMKILAGLHRKPIYICY,YSSRLFDFAPKLIKKQQLQSKFFRRLIYSTYETLVSWRKFWLVCTESDQSTSNAT,IVVEDCLILLQNLLKNNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLHLMLQ

bottom of page