top of page

McDonnell Genome Institute

Washington University

CircRNA

chr4|39503874|39510861|-|UGDH|ENST00000316423.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

VLDGLHNELQTIGFQVNTPTK

Amino Acids from 5' Exons

ELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQ,NWIMNAFIKKCSQPLSSMDGVSWMGSTMNYKPLAS,IGLTHSKNAKASLYLRWTACPGWAPQTTNHWLP

Amino Acids from 3' Exons

VNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQ,ILQQKPMEWGKAGQQISILKLVLDALCKTQMGTKLLRKAQFQCGQQKVSVAYLMQTQNPTIY,EYSNKNLWNGERPGSRSEVYSLCTHCAKLKWVQNCDEKHSSSAGSRKYPSHICKHKTQLEFT

bottom of page