top of page

McDonnell Genome Institute

Washington University

CircRNA

chr4|39113019|39115330|+|KLHL5|ENST00000261425.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9716

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

10

Peptide

LMIPRQMSGPRLYAVGGR

Amino Acids from 5' Exons

TLCSWWSWKFLSQISRMFSSYVDTVCTDVKKERWRRSDDLEWTAVCYRGARCSRIQLDFQTLRLCGK,LYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWNGLLYAIGGHDAPASNLTSRLSDCVE,FMQLVVVMEVLVSNQNVLILILISGHCVHRCQKGEVAERPGMDCCMLGGTMLPHPTLPDSQTVWK

Amino Acids from 3' Exons

ISQNRHVDCSSIHEHQQRCSGGLFTWVICCWGVWTGIPYCGGLSPDKVDP,YDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQ,MIPKQTCGLQHPASAEMQWGSVYLVISYMLLGGMMDRHTLILWRLMIPRQMSGP

bottom of page