top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|41224953|41227352|+|CTNNB1|ENST00000349496.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

15

Peptide

VLSVCSSNKPAIVEADIDGQYAMTRAQR

Amino Acids from 5' Exons

ILMDSMQLELRGYELLCSLRHMRACRSHLHSLMLLIPLMSSVWLNHHRCNMQLTLTIKMMQNLPHVQSLNQNCMTRT,YWTVCNDSSSEGTSCYVPDIRGHADPIYTVCCSSHCPAFGTITDAETCSCKLDLSRCRTCHTCNPTDKTAKRGP,IDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQ

Amino Acids from 3' Exons

LIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA,SSYWLVVDPKLIGPILTKNYCGPQAECRCYLSALVISRLLKL,HHTGWWTPSFSKYNEDLYLRKTTVDHKQSAEGAICLLAGYCRS

bottom of page