top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|193614722|193635522|+|OPA1|ENST00000361150.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9161

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

AFIIESLSEVCQSLVK

Amino Acids from 5' Exons

GLPVFSETQLWNKRKFTTTKTTSGFTKHLSFTSSYLKASTTPIKDILSAVLFSDKPSFTTEILSNIWLPASQEFLASKISYETLKTSLSHTRIGCWGWLHSQK,EVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKK,RSASLNTALEKEVYHYKNYIWFHEAFIIHIILPSFNDPNGHPFSSSLLQTFLYVNNSLQLNMATSLAGIFGQQDLRDSNFAISYDRLLGVATQPK

Amino Acids from 3' Exons

LKYQRILERLEKENKELRKLVLQKDDKGIHHRKLK,SIRESWNDKRRTKNENYCRKMTKAFIIESL,EVSENLGTIRKGEQRIEKISIAERQRHSSKA

bottom of page