top of page

McDonnell Genome Institute

Washington University

CircRNA

chr3|190604127|190645842|+|IL1RAP|ENST00000072516.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9484

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

DSLPGGK

Amino Acids from 5' Exons

NAAMTGDTPGKSKCLKMSQLASSAHSLNTSNSTTAQPIQLALLSGIGLGRTGTLRSQLTSASPRTALVRRKMCCGSGPLSSMTLATIPAC,TLRLGTRHHEANPSVRASSHQVPTLTLLEIQLQHSPFSWPYSDLVLDAGPGPGANLPPPREPHGERCAVVPAHSPQHWQLYLHVK,RCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCML

Amino Acids from 3' Exons

MEKSMIFMYPMQGMRKKKNLYYPSVEFWRMNLDTSCASLTETVCLGE,WKRVYLCILCKECGRRRICITDPPWSFGEIWIQAVHLPRQSAWG,GKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGG

bottom of page