top of page

McDonnell Genome Institute

Washington University

CircRNA

chr21|46490599|46511614|+|DIP2A|ENST00000400274.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9508

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

7

Peptide

AVYTLTYGIDPSLQAENR

Amino Acids from 5' Exons

ETHLCKQRIEFLGPHKPRPLHPSSRSLGPPPRGMSASGQ,NRPISASRENSWALTNHGRCTQAAEVSAHRLEGALPV,IDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS

Amino Acids from 3' Exons

IQISQSLREARRVCEGSLSLQVSPDRRRCWPPCSAGAQHSPNPPVLPWIQLGKPSTLSPM,SKSAKAGKRDECAERGASHCRCPPTAVAVGHLAALGHNTAQIPLSDCLGYNWESRLHSHL,PNQPKPEGSETSVLRGEPLTAGVPRPPSLLATLQRWGTTQPKSPCLTALDTTGKAVYTLTY

bottom of page