top of page

McDonnell Genome Institute

Washington University

CircRNA

chr21|46390669|46399796|+|PCNT|ENST00000359568.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9133

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

GLEQLEEAR

Amino Acids from 5' Exons

LEEARQIHSRFEKEFSFKNEETAQVVRKHQELLECLKEESAAKAELALELHKTQ,WKKHAKFILVLKKNLVLRMRRQHRLSGSTRSCWSVRRRAQQRQSWRWSCTRLR,GRSTPNSFSFKRIFEGDSTGCQEAPGAAGVFEGGERSKGRAGAGAAQDS

Amino Acids from 3' Exons

VELLQQKLREKLDEFNELAIQKESADRQVLMQEEEIKRLEEMNINIRKKVAQLQEEVEKQKNIVKGLEQ,LSCYNKSEKSWMNLMNWLYRKSRQIDKCCRKKKLNVWRRTSTSGKKWPSSRKKWKNRKTSKGWN,VVTTKVERKVGIIGYTERVGRTSVNAGRRNTSGGDEHQHQEKSGPAPGRSGKTEKHRERAGT

bottom of page