top of page

McDonnell Genome Institute

Washington University

CircRNA

chr20|63687637|63695854|+|RTEL1-TNFRSF6B|ENST00000482936.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

MCPACHTASR

Amino Acids from 5' Exons

GRCATGASVPATACTSWSARASAPSSLPAARWPRCPPLLWRCR,EGAELLVLQSRPQHARAGPPGRPLPHPYQRHAGPGVLLCSGDAD,KVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQ

Amino Acids from 3' Exons

ASRMCPACHTASRKQSVMQVFWPEP,PLGCAQPATPPPGSRASCRSSGQSP,LDVPSLPHRLQEAERHAGLLARAP

bottom of page