top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|86464052|86478029|+|KDM3A|ENST00000312912.9

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9474

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

LGVSSVWVWSMCGLLPDEEK

Amino Acids from 5' Exons

ASPSMCPVQSVPTTVFKEILLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQ,PLPVCVLCSLYLQQFLRRYCLAVLRQLHLVRTQDSKVLPRLPTLHLTLEQKFLK,LSQYVSCAVCTYNSFGDTAWLYCGNSTGPKTAKYSPGCQLSTPWSKNSSR

Amino Acids from 3' Exons

DRLLGSELSKVFEKCVMCATPPSSTCTGCVLGVGLEYVWTATGRERIANR,TGCLEASCQRCSRNVCVRHHHLQPALGVSSVWVWSMCGLLPDEEKELPT,QVAWKRAVKGVREMCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQ

bottom of page