top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|32439507|32485759|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9413

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

20

Peptide

MMSTLEADSILQALTNTSPTCMAGGK

Amino Acids from 5' Exons

VWQEENIVRFSMSRQMKEEQKRFVMVVCVLGFHPNTRVTRVIHLLHFWLKLQQA,YGRRKISFVFNPCQGSEKRNRRDLWWYASCSKASIPKTPEQGLFTCFTFGSCSRQ,MAGGKYRSFLIHVKAVNERGTEEICNGGMRPVVRLPSLKHQSNKGYSLASLLAKVAAGK

Amino Acids from 3' Exons

PWMLAKLDLNSKQNCKCLLWRQIPFYRHQIHLLH,PGCSPRSWTTASRTDVENDVYSGGRFHFTGINKYISY,LDARLEVGLEQQAELMLKMMSTLEADSILQALTNTSPT

bottom of page