top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|7440343|7442052|+|CTD-2207O23.3|ENST00000593531.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

YDGLSER

Amino Acids from 5' Exons

PRSRSTPGAPSCPMAARPCPGMSVRSLRKGVPSQHRARLALGRNS,LAQGAPPGHPPVRWQPGPVQECRYDGLSERGSPANTEPGWPWDATR,SLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQL,PRSRSTPGAPSCPMAARPCPGMSVRSLRKGVPSQHRARLALGRNS,LAQGAPPGHPPVRWQPGPVQECRYDGLSERGSPANTEPGWPWDATR,SLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQL

Amino Acids from 3' Exons

IPTPPRGVRLSQTATSLKLSPGASPWMQPTPRSKRGRWKDKMSFM,SLHRLAEEDVRRPRVSVLEPRRGCSLRQEAKEGGGEKTRCPL,PYTASLRSEIESDGHEFEAESWSLAVDAAYAKKQKREVVKRQDVLY,IPTPPRGVRLSQTATSLKLSPGASPWMQPTPRSKRGRWKDKMSFM,SLHRLAEEDVRRPRVSVLEPRRGCSLRQEAKEGGGEKTRCPL,PYTASLRSEIESDGHEFEAESWSLAVDAAYAKKQKREVVKRQDVLY

bottom of page