top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|55677549|55689950|+|EPN1|ENST00000411543.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

SPVFACSVEK

Amino Acids from 5' Exons

EPSLCMQCKRCPSCAERAPGTQQGPRQWGCVPYLSALGFRYPWDVWSSGFPGSSCRP,SPVFACSVEKGNVPLVLSEHLAHSRDPGSGAVRFLISPEPWASAILGTSGLLASPVLPAAL,AQSLHAVLKKVMSLLCASTWHTAGTQAVGLLGSLSLLSLGLPLSLGRLVFWLPRFFLPPW

Amino Acids from 3' Exons

EERIRRGDDLRLQMAIEESKRETGGKEE,RSGSVAGMTCGCRWQSRRARGRLGARR,GADPSRGPAAADGNRGEQEGDWGQGG

bottom of page