top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|54143659|54144332|+|CNOT3|ENST00000618939.4

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9746

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

LIETVGAQSLSPR

Amino Acids from 5' Exons

RLRDQIKTWVASNEIKDKRQLIDNRKLIETVGAQSLSPREVGRSPDSDPKGRRQSGQTPEVLKRSKVSAPKGSEEAADSELRKGHEAQVGVSAGPSAPFPPLRAPLPTALSTANGTVQSCGTRDQNQSLQQRGPGPGPEGRSCPEGEGRGWPVAH,GGTKSRHGRPTRSRTRGSLTTASSLRREPRAVPERWEGHQILEIPRGGGRAARPQRSSREVRFLHLREVKRQRTQSSESRVTRLRSECLLALSQLLSHLEPPCQLHSLQQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLT,AEGPNQDMGSVQRDQGQEAAYRQPQAHDGRSPEPESQRGGKVTRFLRSQGAEAERPDPRGPQEKGFCTGKRGSGLRAQKVGSRGSGRSVCWPLVSSFPTFESPPANCTLYSKWNGSKLWNERPKPKLTAKRAWAWPRRILPRRRRKRLASGS

Amino Acids from 3' Exons

NTIDTLNMQVDQFESEVESLSVQTRKKKGDKD,IPSTRSTCRWTSLRVKWSHCQCRHARRRATR,YHRHAQHAGGPVESGVTVSADTQEEGRQG

bottom of page