top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|45271471|45278615|+|MARK4|ENST00000262891.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9942

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

LAENLLLDAEANIK

Amino Acids from 5' Exons

AENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLK,LRTSCWMPRPTSRLLTLASATSSRWDRSWTRSAGAPHMPPRSCFRARSTTGRRWTSGAWESSCTPSSAAPCPSTGTTS,EPLAGCRGQHQDCLWLQQRVHAGIEAGHVLREPPICRPGAVSGQEVRRAGGGHLEPGSHPVHPRQRLPALRRAQPQ

Amino Acids from 3' Exons

QIMKDKWINIGYEGEELKPYTEPEEDFGDTKRI,KSKTNGSTSAMRVRSSHTQSPRRTSGTPREL,NHERQMDQHRLGGVEAIHRARGGLRGHQEN

bottom of page