top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|17172335|17172963|+|MYO9B|ENST00000397274.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9108

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

AAASPTPR

Amino Acids from 5' Exons

LPPRHEPDPAGQVQTATGQVLPGHPGHGASFHHPALRREGEISDQ,FPHATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIK,SPTPRARPCWPSSNSNMRTISTSWAPRSWSQLSSSSTSQGRNIRS

Amino Acids from 3' Exons

DFREKNMDYMRPDIVALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAA,TSGRRTWTTCGQTSWPCCGAVTAPTCGSSSAWTPWPCSAGPCSGLLSGPWQCFGRPDACGPRGPKRLQ,LPGEEHGLHAARHRGPAAGQQLLRAGAHRHGPRGRVPLGRAPGCYPGHGSASGGRTPAGREGRKGC

bottom of page