top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|8888170|8890912|-|PIK3R5|ENST00000447110.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.979

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LSQASLMAWTAATWR

Amino Acids from 5' Exons

TSCRKSCSRNRSYSSQGSWEMMKRRKRRRRRWRRTWKLTGTVPREIPCSPPALWRPMTPPCPLHPPRPRGRPSRAICLPLSQASLMAWTAATWRTARRAPPSGLGGVAARNAEATAGLGRSSSGSINSSRAPASWYCGGTLGAWRAARTRPCPGGQGASAAPWTNQYHPLPGPSAPAPCPSPNSVPSCPAGFWPLLHAPSAAAPSVEMRIPRLPRYVLWSLAPIGFQGRWLGRTATF,HPAGNPAQGTGATPARDPGRRGGRGGGGGGGGLGNRALCRERFPALHQLFGVPLHLVPCILPGLGAGPLAPSADFLCLRPLWHGQRLRGGQRGELLRVALEAWQPGTPRPPQAWAEVHQDLTLQEHQPAGTAEGLSEPGGQLGHGPAPEAGREPLQPPGRTSITPFPGPALPLPAPAQTRYPAAQLASGPCFTPPAPPPLPEWRGSQGFHATCCGLWLRSDFREGGSGVQQPS,ILQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLSLASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQKFIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNL

Amino Acids from 3' Exons

HRAAAEPSGSAGRVPCCSQAEYARTLASQCLHHPAPARLPGHLWGPLRPGPALQAT,TVLLLNPVEVQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQ,PCCCTQWKCRPSSLLPISVRPDTRLTVPTPPCSCTPSRPPLGPTVTSRACTAGY

bottom of page