top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|5361207|5363016|+|RABEP1|ENST00000341923.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9876

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

DQEHLDSTR

Amino Acids from 5' Exons

EHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKE,SITAPVAQFIPMQACCCHLEILSVNRTMTCLKMDSGEHSLQTAWEPRAHCNPKLAITTKQNLLETWTSQILDHWEQIQCLRTLILHPLGHSRCQVGLCPKIRKEQSRRHQNKKRQRPSSPALPRAWRVPMCPLVVIVLVKQNGISCRK,AFRQHPWLSSFLRCRLAVAIWRSFQIGQHVRWTQESTVYRQLGNLGLIAIQSFRLLQSKICWKPGRVRFWTTGRSRFSVELYCIPWVTPDAKWVYVNQRSGKSNQGDDTRTRRDSVPPLQRYPGHGECLCVPWLSFSNRMESLAER

Amino Acids from 3' Exons

VHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQ,YIMLEINLVDVVICVPITKNSYKEFRFRRLKRET,TCWKTWTLYVFQLRKTVTRNSDSGGNERP

bottom of page