top of page

McDonnell Genome Institute

Washington University

CircRNA

chr16|50222305|50225285|+|PAPD5|ENST00000436909.7

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

CNNNLSEENEALGK

Amino Acids from 5' Exons

KYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQ,NILYCHTWFYNNSYCRGTLMKYLQVELVLIVSFWQSVSF,ISCIAILGFSIETIPIAEGPSIYRWNWFLSLFNGSQFPS

Amino Acids from 3' Exons

EMVLPILSSINVIIIYLKKMKPLENVEVKPRNLLVNTLQTLHQVQCRPLLPHSPALVM,KWCYLDSRYSAVRMSIRKSPWKMKNLGISTLFKLFIRSSVVLFCHTVQLC,NGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQSSSSDV

bottom of page