top of page

McDonnell Genome Institute

Washington University

CircRNA

chr15|99113590|99131813|+|SYNM|ENST00000560674.5

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

VIDCLEDEK

Amino Acids from 5' Exons

RVIDCLEDEKATLTLAMADWLRDYQDLLQVKTGLSLEVATY,ELTAWRMRRQPSPWPWLTGCGTIRTSCRRPASVWRWRPT,SDLPGGEGNPHLGHGLAAGLSGPPAGEDRPQSGGGDLP

Amino Acids from 3' Exons

NSETNPITIPTHYYRGKMKGIYFQGRKHLWQVSITARHCILTCQGTVDLRRAHLLEVMPEEASWARDILPRPLPSRKTHTEKPSAVKPTSELSLQPMAFEILRLKKHSLTDQKPEIQGRSPFTVKIPQLPASRTGIAETRWQQVLRKAHGQMRGPSFWERKQKKPRGSKKETDQKPSEQSQKRKCSILKRRLPRRETDGKNQSIRKRDREKASRRRRLRRRTHRRRRACERERCRLVKYPRTEEQRCPRKVCRRLRMLVVGPVERQKQESYGSGWAPVMPLVLCKAIPQKPQKTSLPVSSSSLSLQRQKHLLILFQTQKSLTWTGKSFLGKGKQRLKLWSLNLRMLMFPMKLAWTTFARILRKWGKASQPSRETSSTSAKGGRGEQRSSTWRSWRSPVMSAGRSRRSFPSHSKWRRSKMCRQAPGGWLRRRKVMEKAMSHSQLISIEGPSSLRRTRLTWKKQRQVIQRASRVILCPLQMNTPGGTTEMTARCTGRSTSRRNPPSGTLGRMKSCRGLEGGHRRTVQWARRLSPWMSQRPLWRGTWVPLTGKNKLEAVNFMPNPQSLKKKLKYPTNSTPPRASPPRSPGSSWWRSSGSWRKPFPSAGRSCPPSPERGRVGRGAFPWMSRRSRVLVAVPPWLLKSTSHKLWMPIGTWRSAKMRPVRWRRLWSRWFGRAAGNAAQRLAAQMRKVERRPRLLAFALGVGPPGSCTSLQARARLLVGPLTARDSALPRAQCRPLWRSAAPQALPSHRCWRMARLQGTNSAPLKSGGLSECHMKDPLQKWW,IQKQILSLYRLTTTEGKKESIFKAESTFGKFQSQLGTVFPVRAPWISDGHIYWRCQKRLLGLGIFFLGHYPAGKLIRKSRQQSNQRQNFLSNLWPFKKYGSSENIPQTKSRRYKGGPRLHRRFHNCPRVVPGSPRQGGSRCFGKHTVKEDRHSGKENRSESHEGARKKQTRNHPNKARRENVRFREGFRGEKPKMGRIDKVRGSETERKPADEGEGGEGLTEGEERARERGADSRSIPGQKSRGVPERFADACEGCWWWDRRGRSKRATVQVGHQCHWFSARRFHDRNRSRKHRYQYPEAVHSVSRDRSICFFSRHKSHLRGQERASWGKENKDNSCGVTDGCCFRSWPGLPFKQGYGSGAERQVSRADDRRHHQPRPEREGGESKGRQRGDRGGARELCQRGEAGGVFRPIQSGGGRRCVARPLGVGGGGRLWRKRCHILSSASKDQAASGEHDSRGRSDRGRFRGRAELFCVHSRTPRGARQRRLGVRADPHRGGIHHQVLLAGNRAGDSKEDTEGRCSGREGCEALGCPSALSGGGPGFHSLERTSKRISCRTHSHKRNNTPRIPHLHEGHLLQGAPAAAGGGHRAAGGNPSRAHEGGAVRPHQRGAGWAGERFRGCQEGPGCWWQFRDPGCSQRLTNCGCRSVRPGGAEQRGQDGEGCGVGGSGEPEQATQPSAWQPRGRWSGGPGCWHSLALGHPGAVHPFRRERGCWWGLSQLGTAHSPGPSVGHCGGQQPHRLCPVTGAGGCEPGCKAHKTRPLSLEDANVIRTHCRSGG,FRNKSYHYTDSLLQRENERNLFSRQKAPLASFNHSSALYSNLSGHRGSQTGTSIGGDARRGFLGSGYSSSATTQQENSYGKAVSSQTNVRTFSPTYGLLRNTEAQVKTFPDRPKAGDTREVPVYIGEDSTIARESYRDRRDKVAAGASESTRSNERTVILGKKTEVKATREQERNRPETIRTKPEEKMFDSKEKASEERNLRWEELTKLDKEARQRESQQMKEKAKEKDSPKEKSVREREVPISLEVSQDRRAEVSPKGLQTPVKDAGGGTGREAEARELRFRLGTSDATGSLQGDSMTETVAENIVTSILKQFTQSPETEASADSFPDTKVTYVDRKELPGERKTKTEIVVESKLTEDVDVSDEAGLDYLLSKDIKEVGLKGKSAEQMIGDIINLGLKGREGRAKVVNVEIVEEPVSYVSGEKPEEFSVPFKVEEVEDVSPGPWGLVKEEEGYGESDVTFSVNQHRRTKQPQENTTHVEEVTEAGDSEGEQSYFVSTPDEHPGGHDRDDGSVYGQIHIEEESTIRYSWQDEIVQGTRRRTQKDGAVGEKVVKPLDVPAPSLEGDLGSTHWKEQARSGEFHAEPTVIEKEIKIPHEFHTSMKGISSKEPRQQLVEVIGQLEETLPERMREELSALTREGQGGPGSVSVDVKKVQGAGGSSVTLVAEVNVSQTVDADRLDLEELSKDEASEMEKAVESVVRESLSRQRSPAPGSPDEEGGAEAPAAGIRFRRWATRELYIPSGESEVAGGASHSSGQRTPQGPVSATVEVSSPTGFAQSQVLEDVSQAARHIKLGPSEVWRTERMSYEGPTAEVVE

bottom of page