top of page

CircRNA

Gene

chr9|93247542|93247834|+|1|circRNA|WNK2|ENST00000448039.5|7

WNK2

Open Reading Frame (ORF)

LARAAAQGAAGCGQPGQGQGSAGAPAGPGDLPCTGWAARATRARGAGGRPAPPATYVADQRHLPGLLSLDSSTRVTSRSWPSPSVTAWP

Peptide

HLPGLLSLDSSTRVTSR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page