top of page

CircRNA

Gene

chr9|92222519|92271655|-|23|circRNA|IARS|ENST00000375643.7|33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11

IARS

Open Reading Frame (ORF)

MGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQGGLSGLYGL

Peptide

LFLNETQTQGGLSGLYGL

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page